.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ehh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dihydrodipicolinate synthase from aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2ehh Target Id aae001001143.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12059, Molecular Weight 32667.96 Da.
    Residues 294 Isoelectric Point 5.48
    Sequence mfqgsivalitpfkegevdyealgnliefhvdngtdailvcgttgesptltfeehekviefavkraagr ikviagtggnatheavhltahakevgadgalvvvpyynkptqrglyehfktvaqevdipiiiynipsrt cveisvdtmfklasecenivaskestpnmdriseivkrlgesfsvlsgddsltlpmmalgakgvisvan nvmprevkeliraalegdfrrareihyylhdlfkvlfietnpipvktacwmlgmcekefrlpltemspe nenklrevlkkynlplkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.23
    Matthews' coefficent 3.18 Rfactor 0.21
    Waters 489 Solvent Content 61.31

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch