.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ei5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical protein(TTHA0061) from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ei5 Target Id ttp001000061.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14831, Molecular Weight 11833.03 Da.
    Residues 106 Isoelectric Point 4.42
    Sequence mqavrlfqgylwhpralaldlkallpgevagarllwdevppptpffedgtpthtqrfyqltllvlteep pealkplaeeaaealgevleglppevgwllledlrpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.88 Rfree 0.241
    Matthews' coefficent 2.12 Rfactor 0.201
    Waters 150 Solvent Content 42.00

    Ligand Information
    Ligands BTB (2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch