The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional and structural basis of nuclear localization signal in ZIC3 zinc finger domain: a role of conserved tryptophan residue in the zinc finger domain. To be Published
    Site RSGI
    PDB Id 2ej4 Target Id ar_001000441.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12160, Molecular Weight 9620.54 Da.
    Residues 82 Isoelectric Point 8.43
    Sequence qpikqelsckwideaqlsrpkkscdrtfstmhelvthvtmehvggpeqnnhvcyweecpregksfkaky klvnhirvhtgek
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch