.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ej5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of GK2038 protein (enoyl-CoA hydratase subunit II) from Geobacillus kaustophilus. To be Published
    Site RSGI
    PDB Id 2ej5 Target Id gka001002038.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12308, Molecular Weight 28365.05 Da.
    Residues 259 Isoelectric Point 6.22
    Sequence ghmyetiryevkgqvawltlnrpdqlnafteqmnaevtkalkqagadpnvrcvvitgagrafcagedls gvteemdhgdvlrsryapmmkalhhlekpvvaavngaaagagmslalacdfrllsekasfapafihvgl vpdaghlyylprlvgrakalelavlgekvtaeeaaalglatkviplsdweeevkqfaerlsamptkaig likrllreseettfdrylereaecqriagltsdhregvkaffekrkplfqgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24229
    Matthews' coefficent 2.37 Rfactor 0.19182
    Waters 466 Solvent Content 48.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch