.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ej8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of APPL1 PTB domain at 1.8A. To be Published
    Site RSGI
    PDB Id 2ej8 Target Id hsk002201400.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12797, Molecular Weight 17510.08 Da.
    Residues 153 Isoelectric Point 5.87
    Sequence etedsilhqlfivrflgsmevksddhpdvvyetmrqilaaraihnifrmteshllvtcdclklidpqtq vtrltfplpcvvlyathqenkrlfgfvlrtssgrsesnlssvcyifesnnegekicdsvglakqialha eldrrasekqkeier
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.84 Rfree 0.23014
    Matthews' coefficent 2.04 Rfactor 0.19332
    Waters 168 Solvent Content 39.61

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch