The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of Biotin Protein Ligase From Methanococcus jannaschii. To be Published
    Site RSGI
    PDB Id 2ej9 Target Id mja001001619.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13386, Molecular Weight 27183.18 Da.
    Residues 237 Isoelectric Point 6.23
    Sequence meiihlseidstndyakelakegkrnfivladkqnngkgrwgrvwysdegglyfsmvldsklynpkvin llvpiciievlknyvdkelglkfpndimvkvndnykklggilteltddymiigiginvnnqirneirei aislkeitgkeldkveilsnflktfesyleklknkeiddyeilkkykkysitigkqvkillsnneiitg kvydidfdgivlgtekgieripsgicihvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.244
    Matthews' coefficent 2.80 Rfactor 0.216
    Waters 206 Solvent Content 56.12

    Ligand Information
    Ligands BTN (BIOTIN) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch