The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of Uroporphyrinogen Decarboxylase From Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2eja Target Id aae001000334.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12035, Molecular Weight 38684.80 Da.
    Residues 338 Isoelectric Point 5.15
    Sequence mpkndlllrslrgepigrfpvwlmrqagrympeyrkirnrvknflelcknvdlateisllplkilgvda iiifsdilvpleplgvkvefvegegpklswsgkvsdlkkydpsqnayvyeiikrvkeaqdevpvigfag apftllsylieggaskdfkstklfmwenpkeykrlmdiltetvlaylkeqikagadvvqifdswvnnls ledygeyvypyvnyliselkdfsdtpviyffrgsssfidlavdyradalsvdwsvdipelfkiydkgfq gnlepavlyaseevieektlgllrripvktryvfnlghglapdmelekvkylvdlvksfplt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.27
    Matthews' coefficent 2.19 Rfactor 0.205
    Waters 751 Solvent Content 43.85

    Ligand Information
    Ligands ACT (ACETATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch