.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ejb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of Phenylacrylic Acid Decarboxylase from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2ejb Target Id aae001000528.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12040, Molecular Weight 21254.82 Da.
    Residues 189 Isoelectric Point 8.75
    Sequence mqkialcitgasgviygikllqvleeldfsvdlvisrnakvvlkeehsltfeevlkglknvriheendf tsplasgsrlvhyrgvyvvpcstntlscianginknlihrvgevalkervplvllvreapyneihlenm lkitrmggvvvpaspafyhkpqsiddminfvvgklldvlriehnlykrwrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.259
    Matthews' coefficent 2.20 Rfactor 0.217
    Waters 79 Solvent Content 43.99

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch