.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ejc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of Pantoate--Beta-Alanine Ligase (panC) From Thermotoga maritima. To be Published
    Site RSGI
    PDB Id 2ejc Target Id tma001001077.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14079, Molecular Weight 32755.04 Da.
    Residues 280 Isoelectric Point 6.06
    Sequence mriietieemkkfseemrekkktigfvptmgylheghlslvrraraendvvvvsifvnptqfgpnedye ryprdferdrkllekenvdcifhpsveemyppdfstyveetklskhlcgrsrpghfrgvctvvtklfni vkphrayfgqkdaqqfrvlrrmvrdlnmdvemiecpivrepdglamssrnvylspeerqqalslyqslk iaenlylngerdaekikeemikhlsrfdkvkidyveivdeetlepvekidrkvivavaawvgnarlidn tilg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.286
    Matthews' coefficent 2.88 Rfactor 0.211
    Waters 199 Solvent Content 57.35

    Pathway

    Reactions found in Metabolic Reconstruction for TM1077

    Name: pantothenate synthase
    Metabolic Subsystem: Pantothenate and CoA Metabolism
    Reaction: : ala-B + atp + pant-R --> amp + h + pnto-R + ppi
    Classification: EC:6.3.2.1
     

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals ZN (ZINC) x 22

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch