The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of histone demethylase LSD1 and tranylcypromine at 2.25A. Biochem.Biophys.Res.Commun. 366 15-22 2008
    Site RSGI
    PDB Id 2ejr Target Id hsk002000585.6
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12598, Molecular Weight 76947.31 Da.
    Residues 700 Isoelectric Point 6.03
    Sequence mlsgkkaaaaaaaaaaaatgteagpgtaggsengsevaaqpaglsgpaevgpgavgertprkkeppras ppgglaeppgsagpqagptvvpgsatpmetgiaetpegrrtsrrkrakveyremdeslanlsedeyyse eernakaekekklpppppqappeeenesepeepsgvegaafqsrlphdrmtsqeaacfpdiisgpqqtq kvflfirnrtlqlwldnpkiqltfeatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptk ktgkviiigsgvsglaaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavv skqvnmelakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqalev viqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpprditaeflvksk hrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildwhfanlefanatplstlslkhw dqdddfeftgshltvrngyscvpvalaegldiklntavrqvrytasgceviavntrstsqtfiykcdav lctlplgvlkqqppavqfvpplpewktsavqrmgfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrge lflfwnlyka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.2447
    Matthews' coefficent 3.68 Rfactor 0.2042
    Waters 100 Solvent Content 66.55

    Ligand Information
    Ligands F2N ([(2R,3S,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3,4-) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch