The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of tRNA N(2),N(2)-Guanosine Dimethyltransferase Trm1 from Pyrococcus horikoshii. J.Mol.Biol. 383 871-884 2008
    Site RSGI
    PDB Id 2eju Target Id pho001001829.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14011, Molecular Weight 43268.95 Da.
    Residues 381 Isoelectric Point 8.67
    Sequence mvnlelievqegkakilipkaesiydspvfynprmalnrdivvvllnilnpkivldalsatgirgirfa letpaeevwlndisedayelmkrnvmlnfdgelreskgrailkgektivinhddanrlmaerhryfhfi dldpfgspmefldtalrsakrrgilgvtatdgaplcgahpraclrkylavplrgelchevgtrilvgvi aryaakydlgidvilayykdhyfrafvklkdgarkgdetleklgyiyfddktgkfeleqgflptrpnay gpvwlgplkdekivskmvkeaeslslarkkqalkllkmidqeldiplfydthaigrrlkietkkveeii salreqgyeatrthfsptgiktsapyevfietikri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.246
    Matthews' coefficent 2.30 Rfactor 0.2
    Waters 336 Solvent Content 46.52

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch