The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of threonine 3-dehydrogenase. To be Published
    Site RSGI
    PDB Id 2ejv Target Id ttk003000029.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14172, Molecular Weight 36636.31 Da.
    Residues 343 Isoelectric Point 6.15
    Sequence mralaklapeegltlvdrpvpepgpgeilvrveaasicgtdlhiwkwdawargrirpplvtghefsgvv eavgpgvrrpqvgdhvsleshivchacpacrtgnyhvclntqilgvdrdggfaeyvvvpaenawvnpkd lpfevaailepfgnavhtvyagsgvsgksvlitgagpiglmaamvvrasgagpilvsdpnpyrlafarp yadrlvnpleedllevvrrvtgsgvevllefsgneaaihqglmalipggearilgipsdpirfdlagel vmrgitafgiagrrlwqtwmqgtalvysgrvdlspllthrlplsryreafgllasgqavkvildpka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.55 Rfree 0.236
    Matthews' coefficent 4.87 Rfactor 0.207
    Waters 180 Solvent Content 74.73

    Ligand Information
    Metals ZN (ZINC) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch