.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ek1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of RNA-binding motif of human rna-binding protein 12. To be Published
    Site RSGI
    PDB Id 2ek1 Target Id hsk002100747.4
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12728, Molecular Weight 8925.77 Da.
    Residues 82 Isoelectric Point 5.24
    Sequence sssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataavid lndrpigsrkvkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.00 Rfree 0.274
    Matthews' coefficent 1.91 Rfactor 0.208
    Waters 439 Solvent Content 35.47

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch