.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ek2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of Project ID PH0725 from Pyrococcus horikoshii OT3 (E140M). To be Published
    Site RSGI
    PDB Id 2ek2 Target Id pho001000725.39
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13889, Molecular Weight 29576.86 Da.
    Residues 265 Isoelectric Point 5.92
    Sequence mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pmgnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.224
    Matthews' coefficent 3.22 Rfactor 0.188
    Waters 438 Solvent Content 61.79

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch