.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ekh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the SH3 domain of human KIAA0418. To be Published
    Site RSGI
    PDB Id 2ekh Target Id hsk002100407.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12706, Molecular Weight 7627.99 Da.
    Residues 67 Isoelectric Point 4.31
    Sequence atsymtcsayqkvqdseisfpagvevqvlekqesgwwyvrfgelegwapshylvldeneqpdpsgke
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch