The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the TGS domain of human developmentally-regulated GTP-binding protein 1. To be Published
    Site RSGI
    PDB Id 2eki Target Id hsk003000406.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12822, Molecular Weight 9372.59 Da.
    Residues 80 Isoelectric Point 9.38
    Sequence ylklvriytkpkgqlpdytspvvlpysrttvedfcmkihknlikefkyalvwglsvkhnpqkvgkdhtl ededviqivkk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch