The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of ST1219 protein from Sulfolobus tokodaii. To be Published
    Site RSGI
    PDB Id 2ekm Target Id sto001001511.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14051, Molecular Weight 18021.89 Da.
    Residues 162 Isoelectric Point 6.84
    Sequence msvkidvirveipegtnviigqshfiktvedlyetlasssphlkfgiafceasgkrlirwdgndeelik laqqtalkigaghtfviyikngfpinvlnriknveevvrifaatanplqvlvaetdqgrgvigvvdgyt plgieteadikerkellrkfgykr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.06 Rfree 0.228
    Matthews' coefficent 2.12 Rfactor 0.18
    Waters 415 Solvent Content 41.86

    Ligand Information
    Ligands GOL (GLYCEROL) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch