.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ekp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of TT0495 protein from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ekp Target Id ttk003000495.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14383, Molecular Weight 25671.29 Da.
    Residues 239 Isoelectric Point 7.79
    Sequence merkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkglvkralealg glhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeagwgrvlfigsvttftaggp vpipayttaktallgltralakewarlgirvnllcpgyveteftlplrqnpelyepitaripmgrwarp eeiarvaavlcgdeaeyltgqavavdggflay
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.15 Rfree 0.169
    Matthews' coefficent 2.61 Rfactor 0.168
    Waters 395 Solvent Content 52.92

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1;GOL (GLYCEROL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch