The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and ligand binding properties of myoglobins reconstituted with monodepropionated heme: functional role of each heme propionate side chain. Biochemistry 46 9406-9416 2007
    Site RSGI
    PDB Id 2ekt Target Id my_001000022.1
    Molecular Characteristics
    Source Physeter catodon
    Alias Ids TPS13688, Molecular Weight 17330.21 Da.
    Residues 154 Isoelectric Point 8.70
    Sequence mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtv ltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalel frkdiaakykelgyqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.10 Rfree 0.158
    Matthews' coefficent 3.09 Rfactor
    Waters 303 Solvent Content 60.22

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch