.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eku

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and ligand binding properties of myoglobins reconstituted with monodepropionated heme: functional role of each heme propionate side chain. Biochemistry 46 9406-9416 2007
    Site RSGI
    PDB Id 2eku Target Id my_001000022.2
    Molecular Characteristics
    Source Physeter catodon
    Alias Ids TPS13689, Molecular Weight 17330.21 Da.
    Residues 154 Isoelectric Point 8.70
    Sequence mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtv ltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalel frkdiaakykelgyqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.1945
    Matthews' coefficent 1.87 Rfactor
    Waters 204 Solvent Content 34.30

    Ligand Information
    Ligands SO4 (SULFATE) x 3;7HE (7-METHYL-7-DEPROPIONATEHEMIN) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch