The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of hypothetical protein MJ1052 from Methanocaldococcus jannaschii. To be Published
    Site RSGI
    PDB Id 2eky Target Id mja001001052.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13376, Molecular Weight 11222.59 Da.
    Residues 100 Isoelectric Point 8.80
    Sequence mifmrkvvaevsiiplgkgasvskyvkkaievfkkydlkvetnamgtvlegdldeilkafkeahstvln dvdrvvsslkiderkdkentierklkaigel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.80 Rfree 0.232
    Matthews' coefficent 2.08 Rfactor 0.192
    Waters 731 Solvent Content 40.96

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch