.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ekz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of Project ID TTHB049 from Thermus thermophilus HB8 (L52M). To be Published
    Site RSGI
    PDB Id 2ekz Target Id ttk003000215.21
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14288, Molecular Weight 19619.44 Da.
    Residues 177 Isoelectric Point 6.44
    Sequence melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdmlrarrtaelagfsprly pelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrfleglkapavlfthggvvr avlralgedglvppgsavavdwprrvlvrlaldgeeatg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.235
    Matthews' coefficent 2.74 Rfactor 0.198
    Waters 369 Solvent Content 55.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch