.
The Open Protein Structure Annotation Network
PDB Keyword
.

2el4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 15th zf-C2H2 domain from human Zinc finger protein 268. To be Published
    Site RSGI
    PDB Id 2el4 Target Id hso003011774.16
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13119, Molecular Weight 3587.01 Da.
    Residues 33 Isoelectric Point 9.90
    Sequence tgvkpygcsqcaktfslksqlivhqrshtgvkp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch