.
The Open Protein Structure Annotation Network
PDB Keyword
.

2el9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of E.coli Histidyl-tRNA synthetase complexed with a histidyl-adenylate analogue. To be published
    Site RSGI
    PDB Id 2el9 Target Id my_001000086.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS13742, Molecular Weight 47026.97 Da.
    Residues 424 Isoelectric Point 5.65
    Sequence makniqairgmndylpgetaiwqriegtlknvlgsygyseirlpiveqtplfkraigevtdvvekemyt fedrngdsltlrpegtagcvragiehgllynqeqrlwyigpmfrherpqkgryrqfhqlgcevfglqgp didaelimltarwwralgisehvtlelnsigslearanyrdalvafleqhkekldedckrrmytnplrv ldsknpevqallndapalgdyldeesrehfaglckllesagiaytvnqrlvrgldyynrtvfewvtnsl gsqgtvcaggrydglveqlggratpavgfamglerlvllvqavnpefkadpvvdiylvasgadtqsaam alaerlrdelpgvklmtnhgggnfkkqfaradkwgarvavvlgesevangtavvkdlrsgeqtavaqds vaahlrtllg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.285
    Matthews' coefficent 3.26 Rfactor 0.227
    Waters 200 Solvent Content 62.31

    Ligand Information
    Ligands HSS (5'-O-[(L-HISTIDYLAMINO)SULFONYL]ADENOSINE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch