.
The Open Protein Structure Annotation Network
PDB Keyword
.

2elf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the SelB-like elongation factor EF-Pyl from Methanosarcina mazei. to be published
    Site RSGI
    PDB Id 2elf Target Id my_001000402.1
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS13754, Molecular Weight 38266.80 Da.
    Residues 350 Isoelectric Point 6.47
    Sequence manvaiigteksgrtslaanlgkkgtssditmynndkegrnmvfvdahsypktlkslitalnisdiavl cippqgldahtgeciialdllgfkhgiialtrsdsthmhaidelkaklkvitsgtvlqdwecislntnk saknpfegvdelkarinevaekieaenaelnslparifidhafnvtgkgcvvlgvvkqgiskdkdktki fpldrdieirsiqshdvdidsapagtrvgmrlknvqakdiergfiisdkeivttdytlectvskftkki epasvlhlfvglqsepvrvekilvdgneveeakpgstcvlelsgnkklayskqdrfllanldltqrfaa ygfsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.225
    Matthews' coefficent 2.41 Rfactor 0.184
    Waters 459 Solvent Content 48.99

    Ligand Information
    Ligands CIT (CITRIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch