The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SWIRM domain of baker's yeast Transcriptional adapter 2. To be Published
    Site RSGI
    PDB Id 2elj Target Id my_001000053.1
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS13735, Molecular Weight 9427.48 Da.
    Residues 81 Isoelectric Point 6.76
    Sequence nmtisdiqhapdyallsndeqqlciqlkilpkpylvlkevmfrellktggnlsksacrellnidpikan riydffqsqnwm
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch