The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 5th C2H2 zinc finger of mouse Zinc finger protein 406. To be Published
    Site RSGI
    PDB Id 2elw Target Id ar_001000687.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12205, Molecular Weight 3725.20 Da.
    Residues 30 Isoelectric Point 9.45
    Sequence ikqhcrfckkkysdvknlikhirdmhdpqd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch