.
The Open Protein Structure Annotation Network
PDB Keyword
.

2enq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the C2 domain from human PI3-kinase p110 subunit alpha. To be Published
    Site RSGI
    PDB Id 2enq Target Id hso002000026.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12902, Molecular Weight 17088.64 Da.
    Residues 151 Isoelectric Point 5.90
    Sequence nsalrikilcatyvnvnirdidkiyvrtgiyhggeplcdnvntqrvpcsnprwnewlnydiyipdlpra arlclsicsvkgrkgakeehcplawgninlfdytdtlvsgkmalnlwpvphgledllnpigvtgsnpnk etpclelefdwfs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch