The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the third ig-like domain from human Advanced glycosylation end product-specific receptor. To be Published
    Site RSGI
    PDB Id 2ens Target Id hss001003863.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13351, Molecular Weight 9268.04 Da.
    Residues 89 Isoelectric Point 4.38
    Sequence leevqlvvepeggavapggtvtltcevpaqpspqihwmkdgvplplppspvlilpeigpqdqgtyscva thsshgpqesravsisiiep
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch