The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Holliday Junction Resolvase ST1444. To be published
    Site RSGI
    PDB Id 2eo0 Target Id sto001001444.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14050, Molecular Weight 16710.57 Da.
    Residues 147 Isoelectric Point 9.72
    Sequence myivnsnksrgssveryivsrlrdkgfavirapasgskrkdhvpdiialksgviilievksrkngqkiy iekeqaegirefakrsggelflgvklpkmlrfikfdmlrqteggnyaidletvekgmeledlvryvesk isrtldsfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.3120
    Matthews' coefficent 2.24 Rfactor 0.2315
    Waters Solvent Content 45.03

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch