The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the insertion region (510-573) of FTHFS domain from mouse methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like protein. To be Published
    Site RSGI
    PDB Id 2eo2 Target Id mmt007020905.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13590, Molecular Weight 7367.05 Da.
    Residues 64 Isoelectric Point 9.30
    Sequence stqtdkalynrlvplvngvrefseiqlsrlkklgihktdpstlteeevrkfarlnidpatitwq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch