The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a mutant pyrrolidone carboxyl peptidase (A199P) from P. furiosus. To be Published
    Site RSGI
    PDB Id 2eo8 Target Id my_001000146.1
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS13751, Molecular Weight 22814.46 Da.
    Residues 208 Isoelectric Point 6.23
    Sequence mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeikpdiaihvgl apgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikkimkklhergipayisnsag lylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigkgqvppsmsyemeleavkvpievaleell
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.23542
    Matthews' coefficent 2.82 Rfactor 0.1847
    Waters 317 Solvent Content 56.44

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch