.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eod

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of TRAF-type zinc finger domains (190 - 248) from human TNF receptor-associated factor 4. To be Published
    Site RSGI
    PDB Id 2eod Target Id hss001001113.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13241, Molecular Weight 8656.61 Da.
    Residues 78 Isoelectric Point 8.64
    Sequence krtqpctyctkefvfdtiqshqyqcprlpvacpnqcgvgtvaredlpghlkdscntalvlcpfkdsgck hrcpklama
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch