The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of Project ID aq_1065 from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2ep7 Target Id aae001001065.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12055, Molecular Weight 37610.95 Da.
    Residues 342 Isoelectric Point 6.17
    Sequence maikvgingfgrigrsffraswgreeieivaindltdakhlahllkydsvhgifkgsveakddsivvdg keikvfaqkdpsqipwgdlgvdvvieatgvfrdrenaskhlqggakkviitapaknpditvvlgvneek ynpkehniisnascttnclapcvkvlneafgvekgymvtvhaytndqrlldlphkdfrraraaainivp tttgaakaigevipelkgkldgtarrvpvpdgslidltvvvnkapssveevnekfreaaqkyresgkvy lkeilqycedpivstdivgnphsaifdapltqvidnlvhiaawydnewgyscrlrdlviylaergl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.215
    Matthews' coefficent 2.75 Rfactor 0.183
    Waters 270 Solvent Content 55.26

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch