.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ep9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Rabbit L-Gulonate 3-Dehydrogenase (NADH Form). To be Published
    Site RSGI
    PDB Id 2ep9 Target Id my_001000051.2
    Molecular Characteristics
    Source Oryctolagus cuniculus
    Alias Ids TPS13734, Molecular Weight 35270.89 Da.
    Residues 320 Isoelectric Point 6.67
    Sequence maspaagdvlivgsglvgrswamlfasggfrvklydieprqitgalenirkemkslqqsgslkgslsae eqlslissctnlaeavegvvhiqecvpenldlkrkifaqldsivddrvvlssssscllpsklftglahv kqcivahpvnppyyiplvelvphpetspatvdrthalmrkigqspvrvlkeidgfvlnrlqyaiiseaw rlveegivspsdldlvmsdglgmryafigpletmhlnaegmlsysdrysegmkrvlksfgsipefsgat vekvnqamckkgpadpehlaarrewrdeclkrelaklkrqmqpq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.214
    Matthews' coefficent 2.25 Rfactor 0.167
    Waters 452 Solvent Content 45.45

    Ligand Information
    Ligands NAI (1,4-DIHYDRONICOTINAMIDE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch