The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first and second zf-C2H2 domains from human Krueppel-like factor 10. To be Published
    Site RSGI
    PDB Id 2epa Target Id hsi002009741.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12422, Molecular Weight 7577.12 Da.
    Residues 65 Isoelectric Point 10.31
    Sequence pqidssrirshicshpgcgktyfksshlkahtrthtgekpfscswkgcerrfarsdelsrhrrth
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch