.
The Open Protein Structure Annotation Network
PDB Keyword
.

2epp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first C2H2 type zinc finger domain of Zinc finger protein 278. To be Published
    Site RSGI
    PDB Id 2epp Target Id hsi002013231.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12491, Molecular Weight 5735.31 Da.
    Residues 53 Isoelectric Point 6.91
    Sequence lreagilpcglcgkvftdanrlrqheaqhgvtslqlgyidlppprlgenglpi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch