.
The Open Protein Structure Annotation Network
PDB Keyword
.

2epv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 20th C2H2 type zinc finger domain of Zinc finger protein 268. To be Published
    Site RSGI
    PDB Id 2epv Target Id hso003011774.21
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13125, Molecular Weight 3502.84 Da.
    Residues 31 Isoelectric Point 6.67
    Sequence sgekpyecnecgkafiwksllivherthagv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch