.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eq5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hydantoin racemase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2eq5 Target Id pho001001054.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13967, Molecular Weight 24982.64 Da.
    Residues 228 Isoelectric Point 6.04
    Sequence myrmdkytiglirvitledkeilnlhgriiesafpelkvvsrciedqpkgiyneetereaepkiirlak eferegvdaiiiscaadpavekvrkllsipvigagssvsalalaygrrvgvlnlteetpkvirsilgnn liaedhpsgvsntldlltdwgrrevinaakrlkekgvevialgctgmstigiapvleeevgipvidpvi asgavalhalkrrevkrfegr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.222
    Matthews' coefficent 2.73 Rfactor 0.160
    Waters 445 Solvent Content 54.97

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch