.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eq6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of lipoamide dehydrogenase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2eq6 Target Id ttk003000509.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14398, Molecular Weight 49081.29 Da.
    Residues 464 Isoelectric Point 6.42
    Sequence mtpmktydlivigtgpggyhaairaaqlglkvlaveagevggvclnvgciptkallhaaetlhhlkvae gfglkakpeldlkklggwrdqvvkkltggvgtllkgngvellrgfarlvgpkevevggerygakslila tgseplelkgfpfgedvwdstralkveeglpkrllvigggavglelgqvyrrlgaevtlieympeilpq gdpetaallrralekegirvrtktkavgyekkkdglhvrlepaeggegeevvvdkvlvavgrkprtegl glekagvkvdergfirvnarmetsvpgvyaigdaarppllahkamregliaaenaagkdsafdyqvpsv vytspewagvglteeeakragykvkvgkfplaasgraltlggaegmvkvvgdeetdlllgvfivgpqag eliaeaalalemgatltdlaltvhphptlseslmeaaeafhkqaihilnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.219
    Matthews' coefficent 2.56 Rfactor 0.199
    Waters 679 Solvent Content 51.98

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch