The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of lipoamide dehydrogenase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2eq7 Target Id ttk003000541.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14410, Molecular Weight 49186.37 Da.
    Residues 455 Isoelectric Point 8.31
    Sequence mydllvigagpggyvaairaaqlgmkvgvvekekalggtclrvgcipskalletteriyeakkgllgak vkgveldlpalmahkdkvvqantqgveflfkkngiarhqgtarflserkvlveetgeelearyiliatg saplippwaqvdyervvtstealsfpevpkrlivvgggviglelgvvwhrlgaevivleymdrilptmd levsraaervfkkqgltirtgvrvtavvpeakgarvelegarswktdrvlvavgrrpyteglslenagl stdergripvdehlrtrvphiyaigdvvrgpmlahkaseegiaavehmvrgfghvdyqaipsvvythpe iaavgyteeelkaqgipykvgkfpysasgraramgetegfikvlahaktdrilgvhgigarvgdvlaea alalffkasaedlgraphahpslseilkeaalaawerpihl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.238
    Matthews' coefficent 2.92 Rfactor 0.207
    Waters 1159 Solvent Content 57.88

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch