The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of a hypothetical Sua5 protein from Sulfolobus tokodaii strain 7. Proteins 70 1108-1111 2008
    Site RSGI
    PDB Id 2eqa Target Id sto001001526.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14052, Molecular Weight 38800.17 Da.
    Residues 352 Isoelectric Point 6.48
    Sequence mtqiikidplnpeidkikiaadvirnggtvafptetvyglganafdgnaclkifqaknrpvdnplivhi adfnqlfevakdipdkvleiaqivwpgpltfvlkktervpkevtagldtvavrmpahpialqliresgv piaapsanlatrpsptkaedvivdlngrvdviidgghtffgvestiinvtveppvllrpgpftieelkk lfgeivipefaqgkkeaeialapgmkykhyapntrlllvenrnifkdvvsllskkykvallipkelske feglqqiilgsdenlyevarnlfdsfreldklnvdlgimigfpergigfaimnrarkasgfsiikaisd vykyvni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.233
    Matthews' coefficent 2.23 Rfactor 0.208
    Waters 180 Solvent Content 44.84

    Ligand Information
    Ligands AMP (ADENOSINE) x 1
    Metals MG (MAGNESIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch