The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Magnesium-bound form of calmodulin C-domain E104D/E140D mutant. To be Published
    Site RSGI
    PDB Id 2eqc Target Id ar_001000846.1
    Molecular Characteristics
    Source Xenopus laevis
    Alias Ids TPS12224, Molecular Weight 16836.73 Da.
    Residues 149 Isoelectric Point 4.09
    Sequence madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtidfpef ltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvn yeefvqmmtak
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch