.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eqe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the fourth A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3. To be Published
    Site RSGI
    PDB Id 2eqe Target Id hsk003100168.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12896, Molecular Weight 3851.20 Da.
    Residues 35 Isoelectric Point 8.45
    Sequence tpgdrtgtskcrkagcvyfgtpenkgfctlcfiey
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch