The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH3 domain from Phospholipase C, gamma 2. To be Published
    Site RSGI
    PDB Id 2eqi Target Id ar_001000485.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12163, Molecular Weight 6572.06 Da.
    Residues 56 Isoelectric Point 8.83
    Sequence rtvkalydykakrsdeltfcrgalihnvskepggwwkgdygtriqqyfpsnyvedi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch