.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eqo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the stn_TRAF3IP1_nd domain of interleukin 13 receptor alpha 1-binding protein-1 [Homo sapiens]. To be Published
    Site RSGI
    PDB Id 2eqo Target Id hso003016239.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13170, Molecular Weight 14855.71 Da.
    Residues 133 Isoelectric Point 9.48
    Sequence mnaavvrrtqealgkvirrppltekllskppfrylhdiitevirmtgfmkglytdaemksdnvkdkdak isflqkaidvvvmvsgepllakparivaghepertnellqiigkcclnklssddavrrvlagek
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch