The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first SANT domain from human nuclear receptor corepressor 1. To be Published
    Site RSGI
    PDB Id 2eqr Target Id hso003013067.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13164, Molecular Weight 6641.28 Da.
    Residues 54 Isoelectric Point 8.07
    Sequence drqfmnvwtdhekeifkdkfiqhpknfgliasylerksvpdcvlyyyltkknen
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch