.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eqs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the S1 RNA binding domain of human ATP-dependent RNA helicase DHX8. To be Published
    Site RSGI
    PDB Id 2eqs Target Id hso002001385.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12979, Molecular Weight 10831.86 Da.
    Residues 96 Isoelectric Point 9.30
    Sequence eeptigdiyngkvtsimqfgcfvqleglrkrweglvhiselrregrvanvadvvskgqrvkvkvlsftg tktslsmkdvdqetgedlnpnrrrnlv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch