The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Regulation through the RNA Polymerase Secondary Channel: STRUCTURAL AND FUNCTIONAL VARIABILITY OF THE COILED-COIL TRANSCRIPTION FACTORS. J.Biol.Chem. 281 1309-1312 2006
    Site RSGI
    PDB Id 2eul Target Id ttp001001042.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14833, Molecular Weight 17182.53 Da.
    Residues 156 Isoelectric Point 4.78
    Sequence marevkltkagyerlmqqlerererlqeatkilqelmessddyddsgleaakqekariearidsledil sravileegsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkisdaspmgkallghrvgdvl sldtpkgrrefrvvaihg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.245
    Matthews' coefficent 2.79 Rfactor 0.206
    Waters 386 Solvent Content 55.98

    Ligand Information
    Metals ZN (ZINC) x 25



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch