.
The Open Protein Structure Annotation Network
PDB Keyword
.

2flf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Purification, crystallization and preliminary X-ray crystallographic study of the L-fuculose-1-phosphate aldolase (FucA) from Thermus thermophilus HB8. Acta Crystallogr.,Sect.F 61 1075-1077 2005
    Site RSGI
    PDB Id 2flf Target Id ttk003000517.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14403, Molecular Weight 21589.59 Da.
    Residues 200 Isoelectric Point 6.72
    Sequence mrarlyaafrqvgedlfaqglisatagnfsvrtkggflitksgvqkarltpedllevplegpipegasv esvvhrevyrrtgaralvhahprvavalsfhlsrlrpldlegqhylkevpvlapktvsateeaalsvae alrehracllrghgafavglkeapeealleayglmttleesaqillyhrlwqgagpalggge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.70 Rfree 0.318
    Matthews' coefficent 2.17 Rfactor 0.225
    Waters 257 Solvent Content 43.27

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch